PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v2827860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 303aa    MW: 34935.4 Da    PI: 6.05
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v2827860.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.73.5e-4771281125
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtd+elv++yL++k++++++++  +ike+d+yk++Pw+Lp ++  +ekewyfF++rd+ky++g+r+nra+ +gyWkatg dk++ +
  Lj4g3v2827860.1   7 LPPGFRFHPTDDELVKHYLCAKCASQPINV-PIIKELDLYKFDPWQLPDMALYGEKEWYFFTPRDRKYPNGSRPNRAAGTGYWKATGADKPIGK 99 
                      79****************************.88***************6666689*************************************98 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmhe 125
                         ++ g+kk Lvfy g+apkg+kt+W++++
  Lj4g3v2827860.1 100 --PKTLGIKKALVFYAGKAPKGVKTNWIIND 128
                      ..778***********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-563159IPR003441NAC domain
PROSITE profilePS5100555.577159IPR003441NAC domain
PfamPF023651.3E-228127IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MQGALELPPG FRFHPTDDEL VKHYLCAKCA SQPINVPIIK ELDLYKFDPW QLPDMALYGE  60
KEWYFFTPRD RKYPNGSRPN RAAGTGYWKA TGADKPIGKP KTLGIKKALV FYAGKAPKGV  120
KTNWIINDDR LANVDRAATK KNNNNLRLDD WVLCRIYNKK GKIEKYESVV GVMDHFSEEN  180
HEMKPEIKMY GHDDFRNEHQ LYTDTSDSVP RLHTDSSCTE EHVLSPEVTC SKEVQSEIKW  240
NELDPVAASF DFDMNLIMDN TNNNNMNMNM NMSAVVDDPF APQVQYQMNQ LSSHFDSYSF  300
WNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-81216510174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.108630.0cell culture| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014509424.11e-150PREDICTED: NAC domain-containing protein 2-like
SwissprotQ8H1151e-112NA102_ARATH; NAC domain-containing protein 102
TrEMBLA0A0B2QC621e-149A0A0B2QC62_GLYSO; NAC domain-containing protein 2
TrEMBLA0A0K2CTE41e-149A0A0K2CTE4_SOYBN; NAC transcription factor
STRINGGLYMA05G32850.11e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63790.11e-110NAC domain containing protein 102